PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30131.m007244
Common NameRCOM_1453680
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 474aa    MW: 53756.9 Da    PI: 6.3103
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30131.m007244genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS451.26.7e-138464691374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPilkfsh 95 
                    l++lL +cA +v++g+ e+a+ +L+++s+las dgd+mqR+aayfteALa r+++  ++ l +al+ +++  + +see+ +++lf+e++P+lk+++
  30131.m007244  46 LIHLLHACASHVAAGSVENANICLEHISHLASADGDTMQRIAAYFTEALADRILKkGWPCLHRALTFTKK--YLVSEEILVQRLFFELFPFLKLAY 139
                    689****************************************************556666666665555..58********************** PP

           GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                    +++NqaI+ea+ege++vHiiD++  +++QW++Llq+L++Rpegpp+lRiTg+++    +ke le+++ rL++ Ae+l++pf+fn+ ++++ledl++
  30131.m007244 140 VITNQAIVEAMEGEKMVHIIDLNSFEPAQWINLLQTLSARPEGPPHLRITGIHE----QKEVLEQMALRLTEEAEKLDIPFQFNP-IMSKLEDLDI 230
                    ******************************************************....9**************************.799******* PP

           GRAS 192 eeLrvkpgEalaVnlvlqlhrll............................................................desvsleserdev 227
                    e+Lrvk+gEalaV++vlqlh+ll                                                            + s     +  ++
  30131.m007244 231 ESLRVKTGEALAVSSVLQLHSLLaaddellkqkspatknskpnhfhiplqigknqrtlgewlekdlvhvytaspdsalsplslAPSP----KMGSF 322
                    **************************************************************************9997654433333....4666* PP

           GRAS 228 LklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaG 323
                    L+++++lsPk++v++eqe++hn+ +++er++eal++y+alfd+le++++r s er+kvE++llg+ei+n++aceg er+erhe+lekW  rle aG
  30131.m007244 323 LNALWGLSPKLMVITEQESNHNGFTLMERVTEALNFYAALFDCLESTVSRPSIERQKVEKMLLGEEIKNIIACEGIERKERHEKLEKWILRLELAG 418
                    ************************************************************************************************ PP

           GRAS 324 FkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                    F+ vpls++ + qa++ll+ ++ dgy+++ee+g+ v++W+drpL+svSaWr
  30131.m007244 419 FGRVPLSYHGMLQASRLLQSYGYDGYKIKEENGCSVICWQDRPLFSVSAWR 469
                    **************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098557.27120449IPR005202Transcription factor GRAS
PfamPF035142.3E-13546469IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MAQEDGASSV TSPPVQFFPW MSLSPGYGSP YPWLRELKSE ERGLYLIHLL HACASHVAAG  60
SVENANICLE HISHLASADG DTMQRIAAYF TEALADRILK KGWPCLHRAL TFTKKYLVSE  120
EILVQRLFFE LFPFLKLAYV ITNQAIVEAM EGEKMVHIID LNSFEPAQWI NLLQTLSARP  180
EGPPHLRITG IHEQKEVLEQ MALRLTEEAE KLDIPFQFNP IMSKLEDLDI ESLRVKTGEA  240
LAVSSVLQLH SLLAADDELL KQKSPATKNS KPNHFHIPLQ IGKNQRTLGE WLEKDLVHVY  300
TASPDSALSP LSLAPSPKMG SFLNALWGLS PKLMVITEQE SNHNGFTLME RVTEALNFYA  360
ALFDCLESTV SRPSIERQKV EKMLLGEEIK NIIACEGIER KERHEKLEKW ILRLELAGFG  420
RVPLSYHGML QASRLLQSYG YDGYKIKEEN GCSVICWQDR PLFSVSAWRF RRYD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-40464694375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002513107.20.0PREDICTED: scarecrow-like protein 3 isoform X2
RefseqXP_015570997.10.0PREDICTED: scarecrow-like protein 3 isoform X1
SwissprotQ9LPR80.0SCL3_ARATH; Scarecrow-like protein 3
TrEMBLB9RGF50.0B9RGF5_RICCO; Transcription factor, putative
STRINGPOPTR_0001s06090.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23833484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.10.0scarecrow-like 3